PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008232318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 591aa    MW: 66330.5 Da    PI: 4.2664
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008232318.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5361331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat++gyWk+tgkd++vl
  XP_008232318.1   6 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPISVIDIYKTEPWDLPgKsKLKTGDLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVL 99 
                     579**************************9.99***************6348888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLvf++grapkg +t+Wvmheyrl
  XP_008232318.1 100 H-NSRNVGMKKTLVFHSGRAPKGARTNWVMHEYRL 133
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-613157IPR003441NAC domain
PROSITE profilePS5100557.8386157IPR003441NAC domain
PfamPF023658.8E-288133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MGRNSLAPGF RFHPTDEELV WYYLKRKVSG KNFRFDPISV IDIYKTEPWD LPGKSKLKTG  60
DLEWYFFSFL DKKYGNSSRT NRATEKGYWK TTGKDRPVLH NSRNVGMKKT LVFHSGRAPK  120
GARTNWVMHE YRLSNEELEK SGIQQKDPYV LCRIFQKSGT GPKNGEQYGA PIAEEEWDDD  180
DVTCVPSELA ADNVVVVSEG PYVETNDVSN GAYVEAFDND QKFDAGIPSE CPPLNFYYGE  240
TSNYVEHSGE FVDDGTTAVM GTGETSEYHE DQKFFDLPVD YEMGGKTVKD EYLTSENYDD  300
LKFFDVPEHS EADAKLVKDE CFIEPSNDTN PADVNYPLNE PYFNTAENPP VGDGLFLETN  360
DLSNPVESTA GFDMLDEYLT YFDADDDISQ YIDFDSCGMM GVENSVPDQS PVDQKQLVNG  420
ETEQLPMGVE HLAQAEDTND ASSSEQKPEF KLESDVNYPF IKKASHMMLG NIPAPPAFAS  480
EFPAKDAILR LNSGSASSSP VHITAGMIRI RDITSSDNRM DWSFGKDGVV NLVFSVQLSQ  540
NDGNSGNLVP MDGSLSGKTG CVVMRGWFLF MFFWVLFLSM SFKIGSYVYT R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-47516316171NO APICAL MERISTEM PROTEIN
1ut4_B6e-47516316171NO APICAL MERISTEM PROTEIN
1ut7_A6e-47516316171NO APICAL MERISTEM PROTEIN
1ut7_B6e-47516316171NO APICAL MERISTEM PROTEIN
3swm_A5e-47516319174NAC domain-containing protein 19
3swm_B5e-47516319174NAC domain-containing protein 19
3swm_C5e-47516319174NAC domain-containing protein 19
3swm_D5e-47516319174NAC domain-containing protein 19
3swp_A5e-47516319174NAC domain-containing protein 19
3swp_B5e-47516319174NAC domain-containing protein 19
3swp_C5e-47516319174NAC domain-containing protein 19
3swp_D5e-47516319174NAC domain-containing protein 19
4dul_A6e-47516316171NAC domain-containing protein 19
4dul_B6e-47516316171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232318.10.0PREDICTED: NAC domain-containing protein 78 isoform X1
TrEMBLM5X3J70.0M5X3J7_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g05240.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-138NAC domain containing protein 2